SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006505 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006505
Domain Number 1 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 48-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 282-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006505   Gene: ENSMODG00000027925   Transcript: ENSMODT00000006640
Sequence length 351
Comment pep:novel chromosome:BROADO5:X:69701668:69710977:-1 gene:ENSMODG00000027925 transcript:ENSMODT00000006640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARQVKRSCKEFLDKGRYCLLKPESGPLAPQLLKGSRRDPAVTESQEASMTFEDVAVYF
TWEEWRQLDFAQRALYRDVMLENYRNAVATGFKGPKPYLISQLERGEMLWILDLRETETT
EARRGTWPDGKTENKESGPKQGIPEDATSQGRLFREGQRENLNGNSARCQQENVVCGSRP
RETDPFREGGPFGDPQEKSYKCNQCKKAFRWKSMLILHHRIHSGEKPYVCNECEKAFSRS
SDLTNHKRIHRGEKPYECNVCGKSFTWSSNLINHKRIHSGERPYKCNICGKSFTQGSILI
KHHRVHSGEKPYECNECGKAFSQKGNLSNHQKIHTRKIIVVSPKKTNPENP
Download sequence
Identical sequences F7E6Y0
ENSMODP00000006505 XP_007507634.1.35504 XP_007507635.1.35504 ENSMODP00000006505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]