SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006522 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006522
Domain Number 1 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-25
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 265-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 40-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 96-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 481-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006522   Gene: ENSMODG00000005289   Transcript: ENSMODT00000006657
Sequence length 542
Comment pep:novel chromosome:BROADO5:X:69664510:69676404:1 gene:ENSMODG00000005289 transcript:ENSMODT00000006657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKPHKCNECGKAFRRSSNLIQHQKIHSGEKPYKCNECGKAFSRSTTLIHHQTIHSGEKPY
ECNECGKAFMASSALIRHQTIHSGERPYECNECGKAFSRNSILIEHKRIHSGEKPYECNE
CGKACRGSSKLIEHQRIHTGVKPYECNECGKTFSQNSHLTQHQRIHTGVKPYQCSECGKA
FRQIATFINHQRIHSGEKPYECNVCGKVFRVRSDLIRHQRIHSGERRYECNECEKTFSQS
SCLIQHRRTHSGEKLYECNECGKNFSRSSNLIQHQRIHSGEKPYECSECGKAFSRSSNLI
QHQMMHTRVIHTGERPYKCNECGKAFRQRSSFINHKRIHSGEKPYECNECGKTFRGSSDL
IKHRRIHSGEKPYECSECGKAFRGSSALLEHQRIHRGEKPYKCQECGKAFRWSSYLIQHQ
RIHSGEKPYKCFECGKDFRGRSHLIRHQRIHTGEKPYGCNECEKAFRASSDLIQHQRIHS
GEKPYECHECGKAFRLISTFINHQRIHSGEKPYECIKCGKAFRRNAYLIRHQRIHTEGKP
YG
Download sequence
Identical sequences F7E6N0
ENSMODP00000006522 ENSMODP00000006522 13616.ENSMODP00000006522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]