SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006812 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006812
Domain Number 1 Region: 147-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000119
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 124-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000126
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006812
Domain Number - Region: 216-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000357
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006812   Gene: ENSMODG00000005504   Transcript: ENSMODT00000006950
Sequence length 279
Comment pep:known_by_projection chromosome:BROADO5:1:604710362:604759944:1 gene:ENSMODG00000005504 transcript:ENSMODT00000006950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKVFLVKRRNPVATIRSWDELPDEERADTYIPAGALMGQGMASHPHSGAGGGGGGGMET
PRRGRGQGGGDIGQSAPPRDHLAPQSGAPEPRTNEEPVLHLAGKRPTARSKIKFTTGTCN
EAMVYSCELCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRP
YKCEICNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVN
SAHPGSAFLKKTSKKLAAILQTKLTSVLQRNAKLSEEDK
Download sequence
Identical sequences F7GFQ5
ENSMODP00000006810 13616.ENSMODP00000006812 ENSMODP00000006812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]