SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007076 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007076
Domain Number 1 Region: 107-471,506-626
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000104
Family GUN4-associated domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007076
Domain Number - Region: 769-834
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007076   Gene: ENSMODG00000005708   Transcript: ENSMODT00000007217
Sequence length 1079
Comment pep:known_by_projection chromosome:BROADO5:2:255963610:255994615:-1 gene:ENSMODG00000005708 transcript:ENSMODT00000007217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLSGSPAGSGAGGPGGAGGLPAAGPGSRLRMLLLESVSGLLQPRTGSATPPSPPTA
PLVPGLVRLLRLHGTMGGAQNLSAVGALVGLSNARLGSIKTRFEGLCLLSLLVAESPTEM
FQQHSVSWLRSIQHVLQSQDPAPTMELAVAILRDLLRYSAQLPELSRDISTNHLPGLLTS
LLGLKPECELSALEGMKACMTYFPRACGSLRGKLASFFLSRVEALSPQLQQLACECYARL
PALGAGFSQGLKHTESWEQELHCLLASLHGLLGALYEGAETAPIQYEGPGVELLLPPPAD
NDVHGLLQLRQRFSGLARCLGLMLSSEFGAPVSVPVQDILDIICRTLSVSGKNISWLGDG
PLRLLLLPSIHLEALDLLSALILSCGSRLVRFGGLICRLLPQVLNTWSAGRDPLPPGQER
PYSAVRAKVYSVLELWVQTCGAGAGVLQGGAQSEALLTHLLSDIFPPADALKLRGPRVTQ
DGGLQSGKPSAPKKLKLDSGEAVVPPMHRKGDSNANSDVCTTALRGLSRTILMCGPLIKE
ETHRRLHELTLPMVMSTQQGEIPGGSPYTSARCRRELYRLLLALLLAPAPQCPPPLTCAL
QAFSLGQREENLEVSSFCSEALVTCAALAHPRVPPLQSPAPSSPPIAPPTQPEPPPPFRA
PSFHPPGPRPPASATANHLGLPVPNLVSAPPRLLPGPENHRAALSEDSAPAPAGTPPPSL
PPDEAFGGRPPRPAFVHYEKEETSDVEISLESDSDDSVVIVPEGLLPLPPAPPQAGTPPP
APPVVATAASPPLPPKEEPEELPPAPGPLPPPPGSGPLPPPQLVAEGTPGGAPPPLEEDL
TVININSSDEEEEEEEEEEEEEEDFPEDEDEEEDEEEYFEEEEEEEEEFEEEFEEEEEGE
LEEEEEEEEEEEEEEELEEVEFEPVEGEVEIRGAPPPDSSPPPPPSEPSKEESEPGLLME
VEETNAEDEKEGESAPPLAPEASPPQGEREEKERTVVPEAPPAEEPTGNEPPALSGEGTD
GKGNQEPLPPAKAAEASATEMETVPKGEKEQDDTAAMLADFIDCPPDEEKPTPPPEPDS
Download sequence
Identical sequences F6U4E3
XP_001370703.1.35504 ENSMODP00000007076 ENSMODP00000007076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]