SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007086 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007086
Domain Number 1 Region: 172-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 129-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 83-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 35-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000373
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 236-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000774
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007086   Gene: ENSMODG00000005716   Transcript: ENSMODT00000007227
Sequence length 284
Comment pep:novel chromosome:BROADO5:4:169740944:169741843:-1 gene:ENSMODG00000005716 transcript:ENSMODT00000007227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQIIHSGEKLYDCKQCGKTFIWRGSLATHEIIHTGEKPYACEHCGKAFERGYLIAHERIH
TGEKHYACKQYGKAFIQRSHLCNQRINTGEKSYECKQCGKAFTQRSNLAKHESIPTGEKL
YACKQCGKAFTKWGYLIAHERMHTGEKPYAFKQYQKAFTQRSSLAKHQSIHGEKPHACKQ
CGKAFTEWVVLIKHQIIHTGEKPYEFKQCGKVFTQRSSLAAHERIHTGEKPYECKHSRLC
KHQRIHTGEKHYKYKQCRKGFTKRSELPNHHSIHTREKVYECNQ
Download sequence
Identical sequences F6U3M3
ENSMODP00000007086 13616.ENSMODP00000007086 ENSMODP00000007086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]