SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007129 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007129
Domain Number 1 Region: 551-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-18
Family Classic zinc finger, C2H2 0.00098
Further Details:      
 
Domain Number 2 Region: 363-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-16
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 302-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.43e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 489-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000212
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000963
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 436-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000303
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 7 Region: 468-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000144
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007129   Gene: ENSMODG00000005757   Transcript: ENSMODT00000007273
Sequence length 728
Comment pep:known_by_projection chromosome:BROADO5:1:685282646:685300408:1 gene:ENSMODG00000005757 transcript:ENSMODT00000007273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEAVEAIMEESETFIKGKERKTYQRRREGGQDEDACHISQTQADGSEVVQEVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVPQEADATVDDTQIITLQVVNMEEQPINLGELQLVQVPV
PVTVPVATTSVEELQGAYENEVAKEGLPEGEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELQPQEDPNWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCTGLDGIDGENGGETKKGKRGRKR
KMRSKKEESSDSEENAEPDLDDNEDEEETAVEIEAEPEVQPVTPAPPPAKKRRGRPPGKS
SQPKQTQPTAIIQVEDQNTGAIENIIVEVKKEPDAETVEGEEEEPQSAVVEAPNGDLTPE
MILSMMDR
Download sequence
Identical sequences F6QDS6
13616.ENSMODP00000007129 ENSMODP00000007129 ENSMODP00000007129 XP_003339817.1.35504 XP_007477233.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]