SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007165 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007165
Domain Number 1 Region: 162-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.62e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 108-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007165   Gene: ENSMODG00000023032   Transcript: ENSMODT00000007312
Sequence length 390
Comment pep:novel chromosome:BROADO5:1:745353523:745360836:-1 gene:ENSMODG00000023032 transcript:ENSMODT00000007312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFQDVAVDFTREEWRLLSPPQKELYKEVMLENVRNLLSVECSTSRLPIDAILGESFE
TFRRVPDTSTTFIDLMELQSVSCTFQYRLGSSSVQKTNHKRKFCVAPQNSSHIEHQRMHT
EEKSSERNQCRKTLMHRASLAGHQKIHTGEKPYECKECGKKFRQSSDLAVHQRIHTGDKP
YECKQCGKSFSQSSHLARHQRIHTGEKPYECKQCGKAFSQSSCLVLHQRIHTGEKPYECK
ECGKTFSMSSHLAVHQRIHTGEKPYECKECGKTFRLSSSLAVHQRIHTGEKPYECKQCGK
TFSRSYYLAVHQRMHTGEKPYECKQCGKMFSRSSHLVVHQRTHTGERPFECNQCGKTFKE
RSKLAVHRRTHTGEKPYECKQCGKTFGRSC
Download sequence
Identical sequences F6XG21
13616.ENSMODP00000007165 ENSMODP00000007165 ENSMODP00000007165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]