SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007174 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007174
Domain Number 1 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-26
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.41e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 55-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 111-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 2-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 326-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000141
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007174   Gene: ENSMODG00000028627   Transcript: ENSMODT00000007321
Sequence length 522
Comment pep:novel chromosome:BROADO5:3:501781822:501783390:-1 gene:ENSMODG00000028627 transcript:ENSMODT00000007321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKSSLAKHQRIHTKEKPYECNECEKTFSRSFSLAAHQRIHTGQKPYKCKQCGKAFRQSS
SLATHQRVHTGEKPYECKQCGKTFSRNSTLVVHHRIHTGEKPYECKRCGKTFSRSSRLAA
HQRIHTGEKPYECKQCGQTFRQISSLAAHQRIHTGEKSYECKQCGRTFSRSSALVVHQRI
HTGEKPYECKECEKTFRQSSSLAAHQRIHTGEKPYKCKWCGKTFRQSSSLASHQRIHTGE
KSYECKQCGKMFSQSSTLAVHQRIHTGEKPYKCNQCGMTFRESYSLAVHLRIHTGEKPYE
CKQCGKTFSHSSSLAVHQRIHTGEKPFECSQCGKTFCRSSHLPVHQRIHTGEKLYECNHC
QKTFSRSSSLAEHQRIHTGEKPYECNQCGKTFKSNSHLSVHQRTHTGEKPYECKQCGKTF
RQSSTLAAHQRIHTGQKPYECKQCGKTFRQNSTLAVHQRIHTGEKPYECKQCGKTFRQNS
TLAEHQRIHTGKNSYECKHCGKIFSWSSHLAIHQRSHTGKEP
Download sequence
Identical sequences F6XFC6
ENSMODP00000007174 ENSMODP00000007174 XP_016288388.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]