SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007252 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007252
Domain Number 1 Region: 613-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 752-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 21-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 696-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 794-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-19
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 10 Region: 252-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.84e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 210-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000015
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 351-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000205
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 491-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000638
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 14 Region: 659-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000928
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 15 Region: 575-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000254
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007252   Gene: ENSMODG00000005854   Transcript: ENSMODT00000007400
Sequence length 846
Comment pep:novel chromosome:BROADO5:4:404878483:404885701:-1 gene:ENSMODG00000005854 transcript:ENSMODT00000007400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHHSAQEGSPKEAGARTLLARSQEAVTFRDVALDFTWEEWRCLSLAQRELYRDVMLENY
RNLVSLAGLLGPKPDLISWLEQREETEIWDPLGWATVGTCSLATGFRFLMRDYIDQDCIN
VGKSFSQSLCQLKRSWNDEECQTLPALIQHQRGNKEENPWDCGELRKTFSQDEPAKGIPI
EEEPFKSTGYKTLRTSSHPIQDQLMQMEDKSYKCKDCEKIFSSHTCLINHERIHYGCKLF
EYKECRKAIKQSPPLVQHQRVRSKEKPYKCKECGKAFRHNSVLVQHQNIHSGKKPYQCKE
CGTAFSQKSYLTKHQSIHTGEKPYQCKECGAAFRQRSYLTKHHRIHTGEKPYLCKECGAA
FSQKSYLTKHQKIHTGERPYPCKECGAAFRQKSHLKQHQRIHAGEKPYPCKECGTAFSQR
SYLTKHQRIHTGEKPYSCNECGIAFSQRSYLTKHQRIHTGERPYQCKECGAAFRQRSHLI
HHQRIHTGEKPYKCGECGKAFRQNSVLVQHQSIHAEEKPYQCKGCGKAFNCKSHLTRHQK
IHTGEKPYECTKCGKAFSRSLTLIAHQNIHTGEKPYKCQECGKAFRHNSGLTQHQGVHTE
EKSYQCKDCGTIFSQKSYLAIHQRIHTGEKPYQCKECGTAFRQRSHLIQHQRIHTGEKPY
KCRECGKAFRQNSVFIQHRKVHTEEKPYQCKECGKSFRQNSVLVQHQRIHTEEKPFQCKE
CGKVFRQYSVLVHHQRIHTGEKPYECIRCGKAFIRRSDLISHQLIHTGEKPYKCRECGKA
FRQNSVLIQHQRIHTGEKPYHCKECGTAFRKRSYLIQHQRIHTGEKPYKCKECEKVFSNC
SALYNH
Download sequence
Identical sequences F6T4X4
ENSMODP00000007252 ENSMODP00000007252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]