SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007271 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007271
Domain Number 1 Region: 97-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-27
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-22
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 6 Region: 2-42
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 7 Region: 45-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000289
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007271   Gene: ENSMODG00000005876   Transcript: ENSMODT00000007419
Sequence length 363
Comment pep:known_by_projection chromosome:BROADO5:2:261708725:261710386:1 gene:ENSMODG00000005876 transcript:ENSMODT00000007419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REKLYKCKECGKSFAVRSFLTQHQRIHTGEKPYKCNECGKVFLVSKLITHQRVHTGEKSS
SFDTCGTTFKQHSELVKCRKNCSRKKTYKCNDCEKIFSDRSNFIRHQRIHTGEKPYKCKE
CGKAFSQSSSLIEHQRTHTGEKPYKCNECGKSFTVSSSLTQHQRIHTGEKPYKCNECGKA
FSDCSSFTQHQRIHTGEKPYKCNECGKAFSDFSSLTQHQRIHTGEKPYKCNDCGKAFSRS
THLTQHQRTHTGEKPYECNECGKAFTAHSTFTQHQRIHTGEKPYECSECGKAFPESSSLT
KHQRVHTGEKPYECSECGKAFSQSTHLIQHHRIHTGEKPYKCNECGKAFGNSSVLLRHQQ
LHT
Download sequence
Identical sequences F6SNA6
ENSMODP00000007271 13616.ENSMODP00000007271 ENSMODP00000007271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]