SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007294 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007294
Domain Number 1 Region: 389-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000146
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 422-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000358
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007294   Gene: ENSMODG00000005896   Transcript: ENSMODT00000007442
Sequence length 486
Comment pep:known_by_projection chromosome:BROADO5:3:368819051:368830275:-1 gene:ENSMODG00000005896 transcript:ENSMODT00000007442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNFGSSLQQPSAERIEMIFEKPKEGGCSWNSTTEKSDFEAVEALMSMSCSWKSDFKKYT
EIRPITPASDVSEETEEGLLPGTSDFHAIPAFCLTPPYSPSDFEASQVPNSVVPAPSIGP
FKSFADTSKPLIAATFKENDQGFLPAPRPLKAQATSVIRHTADAQLCNHRTCPVKAASML
KYQDNVFKRRTHLSIETMRKNVPCAAVSPNRSKCESNTETHVEEKAGAAFNDFSVPSSET
VICSPQQLPASPKQKSVLVPPRAPSASGVPPMPVICQMVPQMVPLPTNNPVVTAVVPNTP
PSQQPALCQPVVFMGTQVPKGAVMFVVPQSVVQNPKPPVMSPNGTRLSPIAPAPGFAPST
TKVTAQIDSLRIRSHICSHPGCGKTYFKSSHLKAHMRTHTGEKPFSCSWKGCERKFARSD
ELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIACPP
TPATAQ
Download sequence
Identical sequences F6SLL2
13616.ENSMODP00000007294 ENSMODP00000007294 XP_001369299.1.35504 ENSMODP00000007294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]