SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007359 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007359
Domain Number 1 Region: 1-407
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.88e-87
Family L-arabinose binding protein-like 0.000031
Further Details:      
 
Domain Number 2 Region: 417-527
Classification Level Classification E-value
Superfamily POZ domain 1.43e-24
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 3 Region: 704-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000248
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007359   Gene: ENSMODG00000005985   Transcript: ENSMODT00000007508
Sequence length 803
Comment pep:known_by_projection chromosome:BROADO5:4:394840704:394863063:1 gene:ENSMODG00000005985 transcript:ENSMODT00000007508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFGIEEINNSSSLLPNVTLGYELYDVCSKSSNVYATLSVLSQPRGNHIRFPENVFNYYP
KAVAVIGPDSTELTSISASLLSTFLVPQISYEATSMMFSEKQKYPSFLRTIPSDKHQVQM
ILMLLKKFGWSWISVIGSENDYGLQGVHLLEDLANQQEICIAYKDFVPILAQAADNTMQN
MMVDINKFGAEVVVVFCNKRLARVFFEAVVLGNVTDKVWLATEDWSISSYITQVPGISRI
GTVIGIAIKQRQVLGMKEFEEAYAQAKNTSEASGGPAQDRGDHTCNQHQALTANANTELS
QFSMNAAYNVYAAVYAVAHGLHQLLGCPSGVCTPGKIYPWQLLAEIRKVNFTLQGNPVSF
DEDGDPVSGYDIITWDWNGPNWTFKVIGTSTWYPVFLEIDGTKIHWHREENQMMDGSFVQ
HSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGTVGSVSLPA
GFAEIFGLLLDFFYTGHLALTAGNRDKVLLAARELHVPEVVELCQSFKPEDFVGQELASP
ETSIPEDLNSHLKWPPDSEEEEVVRVFYTGISVQQPCSPQSPHGAKPSPLGQSESPSSPQ
ERFQQALKPSSIPASPEDKDLQDCKDPQRPLKAGGVLLQAGSNEWEVVVQVEDDADGDDI
SESETVQTTRKSDMAPKAGALEPALSLGPPVSKPRRNRKGTAVPVECPTCHKKFLSKYYL
KVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCLNRSEQVLLGRLVRAPPSLGPRGP
VLSWGWAQTPEKAASSKSPQISE
Download sequence
Identical sequences F6WFQ2
ENSMODP00000007359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]