SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007470 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007470
Domain Number 1 Region: 481-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000021
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 2 Region: 281-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000089
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 385-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000157
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007470   Gene: ENSMODG00000006031   Transcript: ENSMODT00000007619
Sequence length 551
Comment pep:known_by_projection chromosome:BROADO5:1:601905377:601907218:-1 gene:ENSMODG00000006031 transcript:ENSMODT00000007619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGFLVKRNKKSTPVSYRIRCCEDGDRELLLFSSCGGGGGGSSPPLSGSERAPAALLAS
APSAPLLLPPPPPLPLPLPPRELPPPPPVAGPKPVQFGNPEAVYPAPLYSPTRPVSREHE
KKKYFERSFNLGSPVSAESFPTPAALLGGGGGGGGAGGGGGGTCGGDPLLFAPADLKMGT
AFSAAAAAGAEAGGGVPGSVAAASLRHPSKRPAPAPTAEPGAPPAKPAKAPAAKKPKAIR
KLHFEDEVTTSPVLGLKIKEGPVEPPKGRAGGGGGRPLGEFICQLCKEEYADPFALAQHK
CSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPQAPAGGARAAEGKGATDEALAKAGA
GGEQKEAGGSDRDTPSPGVSESGSEDGLYECHHCGKKFRRQAYLRKHLLAHHQALQSKGA
PPPQSLPPPPQPAQPDDLLVYPNFPGADGLQPLPPPEKAGKEAGGEGESSNPLNMSAPAE
CHLCPVCGETFPSKSSQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENRQV
ILLQVPVRPAC
Download sequence
Identical sequences F6ZV15
ENSMODP00000007470 ENSMODP00000007470 13616.ENSMODP00000007470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]