SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007495 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007495
Domain Number 1 Region: 703-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-23
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 7 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 325-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 189-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 12 Region: 745-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-17
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 13 Region: 498-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000337
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007495   Gene: ENSMODG00000006043   Transcript: ENSMODT00000007644
Sequence length 798
Comment pep:novel chromosome:BROADO5:6:244691865:244701309:1 gene:ENSMODG00000006043 transcript:ENSMODT00000007644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQSVTFKDVAVDFTQEEWDYLDPSQKELYREVMQENYKNLVCLAGLAVSQPDVIYHLEQG
RVPWRAEEGILRWSCPVLITKPETKRSPPNLGIYIQQSAQEGFIRHDHYSSKVSRAQEYD
TRLEGHQSNEDKNWGRVKIKQRNMPNKVEGHEYNKYVQSCNQEARIFSKINADDNYFRDN
LNLTENQRKSHKCSECGKTFGNKSALSQHQLVHTGEKPYECIECGKAFSRKAGFIQHQRI
HTGEKTYQCVECGKSFSWNGELTQHQRIHTGEKPYECNECEKTFRQSTQLTQHQHVHTGE
KPYKCNECGKAFRLSTQLTRHHTIHTGEKPYECNECGKAFRQGTQLTQHQCIHTGEKPHK
CNECGKAFLQNMQLTIHQKSHAREESYECRKCGKTFSQKAEFTLHKCIHLGKKSYECNEC
GKAFHLNTLLTQHLYVHSGEKPFECNKCRKSFHRRALLIQHQRIHTREKLYECVECRKTF
SWSGELVQHQCIHTGEKPYKCNECGKAFQESTQLSQHQHIHTGQKPYECNECGKTFRLST
MLNQHQRIHTGEKPYECITCGKTFQQSTQLARHQKIHTGERSYECGECEKAFSQKAELAI
HKRIHTGEKPYECNECGKAFRLSTLLNRHQRIHTGEKPYECSECRKTFRLSTQLIRHKRI
HTGEKPYKCNECGKAFRLRVLLIQHHNIHTGKKPYECNECGKAFRQRTLLTRHQRIHTGE
KPYECNECGKTFSQSAHLAQHQTIHTGEKPYECKECGKAFRLNALLIQHHHVHTGEKPHK
CNECGKAFHKSMQLSRHQ
Download sequence
Identical sequences F6Z624
ENSMODP00000007495 ENSMODP00000007495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]