SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007498 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007498
Domain Number 1 Region: 750-755,791-1168
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.75e-77
Family Formin homology 2 domain (FH2 domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 59-287
Classification Level Classification E-value
Superfamily ARM repeat 2.36e-23
Family Diap1 N-terninal region-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007498   Gene: ENSMODG00000006046   Transcript: ENSMODT00000007647
Sequence length 1319
Comment pep:known_by_projection chromosome:BROADO5:1:684457668:684476906:-1 gene:ENSMODG00000006046 transcript:ENSMODT00000007647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMEDCALQVSPSGYYLDPDLSLEEQREMLDDFYEEIGKGRKPTLILRTQLSIRVHAILEK
LYRSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQ
VMLFVDGMLGVVEHSETVQWLYTLCASVSRLVVKTSLKLLLVFVEYAETNAQLFIHAVNA
VANATGAYPWATFVSILEEKNGADPELLVFTMTLINKTLAALPDQDSFYDVTDALEQQGM
EGIVQKHLGSPGTDADLRAQLVLYESALRLEDGDPEEGVPSGRKERRKPSSEEGKRSRRS
LEGTGSGINSPSRASCPTLPHSKSPVEAHPWEEENNRVCTNQQSYSSPIGPAPCLSSSVV
SFPSPTVSIAHPPSLFPLLPSPSLPSGRWGSRWVEVMVVRCLRTWERFKGVSRCVCRRET
KLPSRPWGPPCAEQVGVSTEWGWPRLAQPGPAQDAVLSASIPLPHVPQGPSGDLLQGSPP
SRNHCFHSSTSGSSAHSSKAQKHRRGEPSTAPDAQTKGSRANKIKLFQKKKQKWFKPSIK
KKNPRWVQSSCKTVSLSREVGRIPGLGTVPNRSRDRGASLAPSALRNAGWKGMRVRGTNR
SSPAEPNIAAAETEKQAALAQGRAEALAEAKLDEADGHPGERSCSGGLGVPLGLPLPQSR
DSRIPLCPLVEGGCSAPRRGAQLLACRVTMVTAFFPIFTDPRELWSTPEPTPTPHSPSTP
RSPLPRPLILAQRSLESEVLTPEAKVTSEPPTPQPSLQIGDLDFSDLGEDEDQDLLATES
AGAGDRKTVKLFWRELKLGQGLKGRGRFGPNPTLWASLEPVTLDTAKLEHLFETRAKEVM
SNKKAAEGRRTMTTVLDPKRSNAINIGLTALPPVHVIKAALLGFDEFAVSKDGIEKLLMM
MPTEEEKQKIQEAQLANPGIPLGPAENFLLTLASIGGLAARLQLWAFKLDYDTMEREIAE
PLFDLKQGMEQLAQNPTFRCILATLLAVGNFLNNTKSCGFELSYLEKVSEVKDTVRRQSL
LYHLCTLVLQSQPDSSDLYSEIPALTRCAKVDFEMLAENLGQLERRSQVAEENLKDLIKH
DLTPALRTRLTHFLSQCARRIAMLKVVHRRVCNRFRAFLLYLGYPAEVAREIRVMPFCHT
LHEFALEYRTCWDRVLQQQRKRATYRERNKTRGRMITETGKFSSMAEAASSLETVPVAVI
SGPDQGDKDTDTSLSSLPSPEPTPTSPGMSRNTPSGAPAVSPTASPEEAPGSGAPSDVSD
EIMDRLVQSVTRCRPRALAAQERKRSRGNRKSLRRTLKGGLGDDLVQALGLSKGPGLEV
Download sequence
Identical sequences F6Z5Y2
ENSMODP00000007498 13616.ENSMODP00000007498 ENSMODP00000007498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]