SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007632 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007632
Domain Number 1 Region: 125-225
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.09e-45
Family Synapsin domain 0.00000219
Further Details:      
 
Domain Number 2 Region: 226-411
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.21e-43
Family Synapsin C-terminal domain 0.0000000346
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007632
Domain Number - Region: 34-39
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007632   Gene: ENSMODG00000006159   Transcript: ENSMODT00000007785
Sequence length 431
Comment pep:known_by_projection chromosome:BROADO5:6:245391748:245622134:1 gene:ENSMODG00000006159 transcript:ENSMODT00000007785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQPPPPPPGSAAGPAGPPAAGSPAPERRP
PPPQAQGQSHQPAPQPAPPQAQPAAPVQSMSSSFFSSLSNAVKQTAASAGLVDAPSSTPA
ASRKSKLLLVIDESHTDWAKCFRGKKVCGDYDIKVEQAEFSELNLVAHADGTYAVDMQVF
RNGTKVVRSFRPDFVLVRQHSFGMAENEDYRNLIIGMHYAGIPSVNSLDSIYNFCDKPWV
FAQLVAIYKNLGGEKFPLIEQTFYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDF
QDIASVVALTQTYATAEPFIDAKYDIRIQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIA
MSDSYSIWVMHVLSHKVYFHSVMDCAMPLIGEHQVEDRQLITDLVITKMNQLLSRTPALS
PQRPSTTQQPQ
Download sequence
Identical sequences F7BS89
ENSMODP00000007632 ENSMODP00000007632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]