SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007692 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007692
Domain Number 1 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 96-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 390-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 1-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 54-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 199-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007692   Gene: ENSMODG00000006192   Transcript: ENSMODT00000007847
Sequence length 450
Comment pep:novel chromosome:BROADO5:1:745518190:745523064:-1 gene:ENSMODG00000006192 transcript:ENSMODT00000007847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFRDVAVDFTREEWRLLSPPQKELYKEVMLENARNLLSVGKESPSPSIIPQMHTGEKPY
ECKQYGKTFSHSSGPVNHQRKHIGEKPHTCKQCGKTFTKRSGLVYHERMHTGEKPYECKQ
CGKTFRQSSDLGVHQRLHTWVKPYECKQCGKTFNQSSHLASHQRVHSREKPYECKQCGKR
FSHSSGLALHQRLHTGEKPYECKQCGKTFNQSSYLASHQRVHSREKPHGCKQCGKTFRRS
WVLAMHQRTHTGEKPYECKQCGKTFTRSSSLASHQRLHTGEKPYQCKQCGKTFRRTSDLA
SHQRLHTGEKPYECKQCGKAFTQWSGLACHQRMHTGEKPYECKQCGKTFTQSSGLAVHQR
LHTGEKPYDCKQCGKPFTYSSGLAYHQRIHTGEKPYECKQCQRTFSHSSGLAYHQRTHTG
EKPYECKQCGKTFTQSSALAVHQRLHTGEK
Download sequence
Identical sequences F6ZSW2
ENSMODP00000007692 ENSMODP00000007692 13616.ENSMODP00000007692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]