SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007698 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007698
Domain Number 1 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 312-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 135-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.58e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-16
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000575
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 
Domain Number 8 Region: 218-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000416
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007698   Gene: ENSMODG00000006211   Transcript: ENSMODT00000007853
Sequence length 467
Comment pep:known_by_projection chromosome:BROADO5:6:119530104:119534739:1 gene:ENSMODG00000006211 transcript:ENSMODT00000007853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQGLVVFEDLAVYFSQEECIHLHPIQKELHSDIKQDSFMDVIPLGKDLKNLQQENAESIV
SQEVSPTLISELGKVTMDESRRPEGRRLGLSQEKRFISLLITIDNPPLRELSECIENIFF
ERDIYLPELGVATAYRCHECGKNFTKSSRLTSHQRIHTGEKPYECADCGKSFTQRSTLTT
HRKIHLAERPYQCAHCGKTFRRSTHLLQHETIHTREKPYKCDQCGESFTWNFQILQHQKV
HTGGKPYKCVLCERSFRRNSDLTTHQRIHTGERPFKCVECGKSFSQRSNLITHNRTHTGE
KPYKCVNCGKIFRRSSHLTRHEITHTREKIYTCNECGKTFTVHIELVRHQKIHEKEKPYC
CNKCGKSFSWRADFITHQRLHSREKIYKCFTCEKSFGLNSHLIIHERTHIGKKRYQCTEC
DKSFCRNFDFTVHQRLHTGERPYNCGSCGKNFSRNSHLIRHRKIHIR
Download sequence
Identical sequences F6ZSN4
13616.ENSMODP00000007698 ENSMODP00000007698 ENSMODP00000035478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]