SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007733 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007733
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-40
Family SCAN domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 436-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 217-274
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-17
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Domain Number 6 Region: 483-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000452
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007733   Gene: ENSMODG00000006236   Transcript: ENSMODT00000007888
Sequence length 509
Comment pep:known_by_projection chromosome:BROADO5:6:119591695:119607450:1 gene:ENSMODG00000006236 transcript:ENSMODT00000007888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFRKMATALGLKVQSPLEQEEILIVKVEEDFPWEEEPPSQRNDPSPETFRQLFRLFCYQ
EVAGPREALSRLWELCCRWLRPEMRTKEQILELLVLEQFLTVLPGEIQTWVREQHPESGE
EAVVLVEVLKHELSAKMVPQRIAQKSLIFQGAVQHEAMAQEEGTQNSCLGPREQPNRRSK
KNPQLRPKRGSPTSRISALFREESTRDQGTATAFISAWSQMPVTFEDMAMYLSQEEWGRL
NPEQREHYQNVLQENYGNIIMPKCEIKIEDEEDSREDSTMEMELYRTQAGKSKGCGHQPA
HQGQACVTRSEWHQGYPPLERESQTCVQERDIGLQRACIVEKPYKCLECGKSFNKSSHLI
KHQRTHTGEKPYKCLVCGKGFSDRSNFSTHQRIHTGEKPYKCNECGKCFSQSSSLVIHRR
THTGERPYKCGECGKSFNNSSHFSAHRRTHTGEKPYMCQNCGKSFRRGTDLNKHQRTHTG
ERPYKCAVCGKSFTRKHQLVTHQEIHEGE
Download sequence
Identical sequences F7FS13
ENSMODP00000007733 ENSMODP00000007733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]