SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007736 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007736
Domain Number 1 Region: 8-127
Classification Level Classification E-value
Superfamily POZ domain 3.14e-24
Family BTB/POZ domain 0.00075
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.6e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 400-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-16
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 341-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000266
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007736
Domain Number - Region: 309-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00175
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007736   Gene: ENSMODG00000006238   Transcript: ENSMODT00000007891
Sequence length 706
Comment pep:known_by_projection chromosome:BROADO5:1:597541386:597557370:-1 gene:ENSMODG00000006238 transcript:ENSMODT00000007891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGAVLLQSKSSPINLLNEMHQLRLLGHLCDVTVSVEYQGVREEFMAHKAVLAATSKFF
KEMFLNETAMDGTKTNVYLNEVQVVDFASFLEFVYTAKVQVEEDRVQRMLEMAEKLKCLD
LSETCFQLKKQMLESVLLELQNFSESQEPGENNTFQTNDVVLDSVASIIVEVPNDDSLSD
SSDYPAERNSNGLIPQTTQRKSKDKVDKKNEVMKPPYPKIRRASGRLAGRKVFVEIPKKK
YTRRLREQQKNADDSVENKSPEDQSILDVEMVIEPVTKNVEPKNEECDASFELEEALKKA
EEKDNKKKGNFKCITCEKEFLYEKSFLKHIKHNHGIAAEITYHCDTCSQTFANKCNLKSH
QRHVHSSERHFPCELCGKKFKRKKDVKRHILQVHEGGGERHQCQQCGKGLSSKTALRLHE
RTHTGDKPYGCTECEAKFSQHSALKTHMRIHTGEKPFVCDECGARFTQNHMLIYHKRCHT
GERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERP
YCCDQCGKQFTQLNALQRHHRIHTGEKPFMCNACGRTFTDKSTLRRHTSIHDKNTPWKSF
LVIVEGSPKNEDSHKTEQMDEDYPSPKISEKLLSFAENGHFQNLTAVQGALTALHENSPT
TDLDCKSDDPAVPQETLIATTLSDLTVLHIQTDSVQPSLHALSNIE
Download sequence
Identical sequences F7FS07
13616.ENSMODP00000007736 ENSMODP00000007736 XP_003339714.1.35504 XP_007476677.1.35504 XP_007476678.1.35504 XP_016282296.1.35504 ENSMODP00000007736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]