SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007744 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007744
Domain Number 1 Region: 143-277
Classification Level Classification E-value
Superfamily Acid proteases 1.41e-42
Family Retroviral protease (retropepsin) 0.0000705
Further Details:      
 
Domain Number 2 Region: 21-152
Classification Level Classification E-value
Superfamily dUTPase-like 3.66e-24
Family dUTPase-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007744   Gene: ENSMODG00000006245   Transcript: ENSMODT00000007899
Sequence length 296
Comment pep:novel chromosome:BROADO5:5:241676831:241677721:-1 gene:ENSMODG00000006245 transcript:ENSMODT00000007899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSTGKRGAGLLWEPLSSSLTRATAGSAGLDLCASTTRILTPEEGPIILPTGKFGPPPPG
MFFLVIGRALTTLQGVVVHPTLVDNDYTGEIKIIIESPHDPVTIPAGKRLAQALPLPMIG
NFPAVAHTRGPSSPGSSNIYWVQQLTESRPTLQLKIEGKTFTGLLDTGADSTVISQAHWP
RSWPLQPSSTHLSGIGQVQDTLQSSKILNWQDTEGNRGTIRPYIVAGLPVNLWGRDILAQ
MRLLMVSPSDPVTTMMLKSGYLPGKGLGKREQGLPHPISFRPHKDREGVGLQSFCS
Download sequence
Identical sequences F7FRX0
13616.ENSMODP00000007744 ENSMODP00000007744 ENSMODP00000007744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]