SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007768 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007768
Domain Number 1 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 58-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 442-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 181-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007768   Gene: ENSMODG00000023636   Transcript: ENSMODT00000007925
Sequence length 513
Comment pep:novel chromosome:BROADO5:3:502931849:502944565:1 gene:ENSMODG00000023636 transcript:ENSMODT00000007925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLGVLCCLYREPGIPGMTLERDKLPTQHLPPWLWLWHFVDSHTDAGCPEKQHQGHRQE
VVTFQDVAVDFTREEWRLLSPPQKELYKEVMLENAQNLHSVGLPTPPEDVFSSLEQREVP
WILEQEALRNCCPEGEIRPEMKENPTEMSPSVEEMELQRFMSDGPNKLPFKREFCVAPQN
LSHIEHQRMHTGEKSIEINEFGKTFMHRASLSRHQRNYTKERPNECREYEKTFSQSSSLV
KHQSIHTGEKPYECKQCGKTFLWSSSLAVHQRIHTGEKPYECKHCGKTFIQSSCLAAHQR
IHTGKKPYECKQCGKTFRTSSLLDVHQRIHTGEKPYKCNQCGKTFSQSSHLTVHRRIHTG
EKPYECKPCGKAFKQRSKLIVHQRIHSGEKPYECKQCGKAFKERSKLIVHQRIHTGEKPY
ECKQCGKTFIQKSNLATHQRIHTGEKPYECQQCGKAFSCNSHLAVHQRIHTGEKPYECKQ
CGKTFSHSSSLAFHQRIHNGGGTLRIQAVWKGI
Download sequence
Identical sequences F7FDZ8
ENSMODP00000007768 ENSMODP00000007768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]