SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007781 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007781
Domain Number 1 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 456-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 307-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000391
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007781   Gene: ENSMODG00000025179   Transcript: ENSMODT00000007938
Sequence length 506
Comment pep:novel chromosome:BROADO5:7:64617193:64634218:-1 gene:ENSMODG00000025179 transcript:ENSMODT00000007938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVTFKDVAVDFTREEWCLLAPPQKELYKEVMLENAWNLLSVGLPESPEDMISYLKQRE
AQWMLEQEGLRSCCLGEESVCDFLKRSVFETEGANVIMWEALCSLNCCEIRPDMNVTPTE
GSFSVEETEKQKFMSDGLDHLAWRELCVDFQNSSFREYQRMKSEEKSHECNQCGKTFTHR
ANLAGHQRIHTGEKPYECKQCGNTFSESSSLVVHQRIHTGVKPYECQQCGKIFSRSSSLA
VHQRIHTGEEPYECQQCGKTFRQSSRLAVHQRIHTGEKPYECKQCGKTFSRSSSLAVHQR
IHTGVKPYECKQCGKTFSHSSSLAVHQRIHTGEIPYECKQCGKTFSHSSSLAVHQRIHTG
EKPYECKQCGKTFSHSSSFTVHQRIHTGEKPYECKQCGKTFNQSSILSLHQRIHTGEKPY
ECKQCGKTFSWSSQLAVHQRIHTGEKPYECKQCGKTFSQSSRLAVHQRIHTGEKPYECKQ
CGKTFNQGSNLAVHQRIHTGEKPYEC
Download sequence
Identical sequences F7FDP1
ENSMODP00000007781 ENSMODP00000007781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]