SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007819 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007819
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 125-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 69-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 2-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 293-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000161
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 172-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000158
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007819   Gene: ENSMODG00000006295   Transcript: ENSMODT00000007976
Sequence length 335
Comment pep:novel chromosome:BROADO5:X:42509651:42510655:1 gene:ENSMODG00000006295 transcript:ENSMODT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VENPYECKDCGKAFRLNIELIQHERIHSGEKPHECEECGKTFKGHSELIEHERIHSGAKP
YKCKECGKAFRRSSGLSRHRRIHSIVKPYRCNECGKSFKRSTGLSQHQKVHSGEKPYECN
ECGKAFKVSTHLIRHQRIHSGEKPFECSDCRKGFREHSDLIKHQRIHTGEKPFKCDECGK
AFRGQSGLLEHQRIHSGAKPFECIQCGKAFRRSSELTKHRRIHTGEKPYECKECGKPFRQ
SSSLLEHQRIHTGEKPYECIECGKTFRGPSDLIKHRRIHSGAKPYECNECGKTFRRSSGL
NRHRRIHSVASLHACSECGKAFKKSSALYRHQKTH
Download sequence
Identical sequences F7BS13
ENSMODP00000007819 13616.ENSMODP00000007819 ENSMODP00000007819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]