SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007899 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007899
Domain Number 1 Region: 594-602,655-1032
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.88e-109
Family Formin homology 2 domain (FH2 domain) 0.00000000219
Further Details:      
 
Domain Number 2 Region: 127-483
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-106
Family Diap1 N-terninal region-like 0.00000000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007899   Gene: ENSMODG00000006363   Transcript: ENSMODT00000008058
Sequence length 1118
Comment pep:known_by_projection chromosome:BROADO5:7:154647817:154984640:1 gene:ENSMODG00000006363 transcript:ENSMODT00000008058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSRSRRPHQPHGLAGESSSTSSSSSSSSRSGRDTKPPRRKGHPLGPPPAFSEEPGEKR
AKFHLNIRTLTDDVLDRFASIRIPGSKKERPPLLNLKHTFSSSTDWPSASSDMMENNPRL
LSEKELLALFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYMNTATKLGCLKSSRQISP
QEFIHELKMGVADERLVTCLESLRVSLTSNPVSWVENFGHEGLGLLLDILEKLIGSKNQE
KIVKRSQHKVIQCLKALMNTKYGLERIMGEEKCLSLLAKAMDPQQANMMVDIVKLLSAIC
IVGEENVLEEVLEALTTVGEEKKIDRFSSIVEGLQENSVQLQVACMQLINALVTSPDDLD
FRLHIRNEFMRCGLKQILPNLKHVKSESLDIQLKVFDEHKEEDFIEFSHRLEDIKTELDE
ASEVYNMLWNTVKETRAEGYFLSILQHLLLIRNDYYIRPQYFKLIDACISQIVLHRDGTD
PDFTYRKKLDIDLRQFVDVCVDQAKLEEFEEKVSEFSKKFEKEFTVHQETQSQLQKKEVK
ITELQAELQAFKTQFGALPPGSKNSLTQSIGEVTGQPSPPLPSLPLGGGVPPPPPPPPPP
PPPPLPGMPMAFGAPLPPPLPPGILGVHRSPPPLTLPFGLKPKKEFKPETTMKRLNWLKI
RPHEMTENCFWLKANENKYENTDLLCKLENTFCCQRKEKKEEEDFAEKRTIKKRIKELKI
LDSKIAQNLSIFLGSFRVPYEEIKIMILEVDETQLAESMIQNLIKHLPDQEQLNSLSKLK
NEYNNLCEPEQFAVVMSTVKRLRPRLSAILFKLQFEEQVNSLKPDILAVSAACEEIKKSK
SFSKLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLAEVCEEKY
PDILNFVDDLEHLDKASKVSVENLEKNLKQMGRQLQQLEKDLDSFPSPEDKHDKFLTKMS
IFVISAKEQFQKISRMHENMEKSYQSIMVYYVIDMKKVSVEEFFTDLNNFRTMFMQAVKE
NTKRREAEEKEKRARIAKELAEKEKIERQQKKKRLIEMKTEGDETGVMDSLLEALQSGAA
FRDRRKRTPRPKDIRQSLSPISQRPVLKARNHGNQQYL
Download sequence
Identical sequences F6ZQT6
ENSMODP00000007899 ENSMODP00000007899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]