SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007911 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007911
Domain Number 1 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 60-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 3-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-25
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 115-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 332-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000508
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 248-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000144
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007911   Gene: ENSMODG00000008415   Transcript: ENSMODT00000008071
Sequence length 530
Comment pep:novel chromosome:BROADO5:4:402109384:402141026:-1 gene:ENSMODG00000008415 transcript:ENSMODT00000008071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRTFRSSSDLRKHQRIHTGEKPYECKQCGKCFTKKSNLHEHQRIHTGEKPYKCKQCGKGF
TKSSRLTVHQRIHTGEKPYECKQCGKGFTQRFNLAAHQRIHTGEKPYKCNQCGKAFTQRN
ILAAHQRIHTGEKPYKCEQCGKAFRTNSNLGKHQRMHTGEKPYECNQCRKTFSKSSSLAK
HQRIHTGEQEKPYECNQCGRAFTMSSRLAIHQRIHTGEKPYECHQCGKAFTQRYVLTAHQ
RIHTGEKPYECNQCRKTFTKSSRLAKHQRIHTGEKPHECNQCGKTFTQKDVLAVHQRIHT
GEKPYECNQCGKAFRSTSDLRKHQRVHSGEKPYECNQCGKAFTQRGNLAQHQRIHTGRKA
YECNQCGKAFTKSSILDKHQRSHSGEKPFKCNQCGKCFTKNSRLTIHQRIHSGEKPYECN
HCGKAFTQKDVLAVHQRIHTGEKPYQCNQCEKAFRSSSDLHKHQKTHTGEKPYQCNQCGK
AFTQKDVLAVHQRIHTGEKPYECNQCLKAFRSSSDLRKHQRIHTREKLYE
Download sequence
Identical sequences F7G2J1
ENSMODP00000007911 ENSMODP00000007911 13616.ENSMODP00000007911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]