SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007941 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007941
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily SET domain 1.26e-23
Family Histone lysine methyltransferases 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007941
Domain Number - Region: 133-245
Classification Level Classification E-value
Superfamily TPR-like 0.00235
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007941   Gene: ENSMODG00000006404   Transcript: ENSMODT00000008103
Sequence length 255
Comment pep:known_by_projection chromosome:BROADO5:2:141558492:141835667:1 gene:ENSMODG00000006404 transcript:ENSMODT00000008103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLQVICNGFAISNGEMQEVGVGLYPSMSLLNHSCDPNCVIVFEGPSLFLRAVRDIQQGE
ELTICYLDVLMPSAERQKQLKEQYCFDCDCPGCETRSKDDDMLSGEEQAWKEVQDSLKKV
EDLRAQEKWEQILAICQTLINNYGDRLPDRNIYQLKMLDCAMDACINLCLWEDALLYGSR
TLEPYRLYYSGFHPISGVQVMRVGKLQHHQGLYPQALETLKQAFELMKVTHGRDHSLVED
LLLLLGDCEANLRAG
Download sequence
Identical sequences F7FRC7
ENSMODP00000007941 ENSMODP00000007941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]