SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007967 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007967
Domain Number 1 Region: 294-661
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-78
Family Motor proteins 0.0000285
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007967
Domain Number - Region: 966-978
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00785
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007967   Gene: ENSMODG00000006420   Transcript: ENSMODT00000008130
Sequence length 1980
Comment pep:known_by_projection chromosome:BROADO5:2:141889145:142366108:-1 gene:ENSMODG00000006420 transcript:ENSMODT00000008130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCISTYGQPGCLTDPAFSSAIHDKLQVPNTIRKAWNERDNRCDICATHLNQLKQEAIQMV
LTLEQAAHSEHYDAASPSSPPPLANIPALVGPRHVGGLQQPRDWAFVPASYATSNYTGFL
PNKHGSKPNSLGVGSGAEKKNGSPTHQAKVSLQMATSPSNGNILNSVAIQAHQYLDGTWS
LSRTNGVTLYPYQISQLMTDPGREGLTEAALNRYNADKPSVYSFPASQSPCAASETSQGT
SVAASFFARAAQKLNLSSKKKKNRPSTSSASESPLFSTSFSGILQASPPPAPPCLLRAVN
KVKDTPGLGKVKVMVRICSTLARDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGN
QVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKD
DSMQNLGIIPCAISWLFKLINERKEKTGARFSVRISAVEVWGKEENLRDLLSEVATGSLQ
DGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSH
MLFTLHIYQYRMEKSGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVI
LALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISAAAGNYAETLSTIQIASRVLR
MKKKKTKYTSSSSGGESSCEEGRMRRPTQLRPFHPRNAVDPDFPILHLSSDPDYSSSSEQ
SCDTVIYVGPNGTALSDKELTDNEGPPDFVPIVPALQKTKNNSRLEDAGDSASNKSERDC
LKCNTFAELQERLDCIDGSEETNKFPFEELPIQFGADQMSKCPTLSSQVAEVSQLSDSDK
EENGSDGQLLDKEGQESTSPLVTKLQRNHSPVPSAAFSNTPTPSSPRSIPGSSSSQPSAS
QLTQSPSLQSSRESLNSCGFVEGKPRPMGSPRLGIASLSKTSEYKPPNSPSQRCKVYTQK
GVLPSPAPPPPPPPPPLTKDSGMVSSESLLQPEIRTPPVGMSPQVLKKSVSSGSGGFSET
IIDEEQSATSPGSKKGVLSTTMVTVQQPLELNGEDELVFTLVEELTISGVLENGRPTSII
SFNSDCSVQALASGSRPVSIISSISEDLECYSNTAPVSEVSITQFLPLPKLNLDEKVRDA
GSRRSSISSWLSEMSTGSDGEQSCHSFIAQTCYGHGEALADPPLPDFANAIQNTRMMCGD
KPKAGPENLLILSEMGEEVFNKGSPLKGCKISALGKAMVTISNAANLGGCDGYIPMKTNI
TVYPCISVSPLNIQETDEAITSVNSSSKAAQSQEGKEASTKKEIKFEDPWLKREEEVKKE
NTYPSNVTSFENEMGSTKPEPRHEQEEGKKPNSVDRFSSSSSSGETSNSPVSDNFKRIVD
GCEMTLSSLATQTPVHANKSLKASSLPRAFQKASRLDDLDSVFYHCAAESNGICSAGSQS
SKTTLERRMASPKHCVLARPKGTPPLPPIRKSSLDQKNRASPQHSAPSSSTSSPLNQPAP
FLPGFPDEPNSKTKDTSSSKLFSAKLEQLASRSNSLGRSTVSHYECLSLERAESLSSVSS
RMHSGKDSTMPRTGRTLNRSAMSSPTNSCTSQSAGASPKAGQSKISAVSKLLLASPKARS
LSTSTTKTLSFSTKSLPQSVGQSSSLPPSGKHMSWSTQSLSRSRGSGLTSKLPLRAVNGR
ISELLQGNTNTRGLQLRGSSEAEERGGLPGEEKPAVHMLPSPYSKITPPRKPHRCSSGHG
SDNSSVLSGELPPAMGKTALFYHSGGSSGYESMMRDSEATGSASSAQDSMSENSSSVSGR
CRSLKTPKKRSNSGSQRRRLIPALSLDTTSPVRKPSNSAGVRWVDGPMRSTQRGLGEPFE
IKVYEIDDVERLQRRRGIDNKEVICFNAKLKILEHRQQRIAEVRAKYEWLMKELEMTKQY
LMLDPNKWLSEFDLEQVLELDSLEYLEALECVTERLENRVNFCKAHLMMITCFDITSRRR
Download sequence
Identical sequences F7FCR6
XP_007481580.1.35504 ENSMODP00000007967 ENSMODP00000007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]