SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008125 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008125
Domain Number 1 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 18-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 555-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-16
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008125   Gene: ENSMODG00000006548   Transcript: ENSMODT00000008289
Sequence length 609
Comment pep:novel chromosome:BROADO5:Un:71412249:71417584:1 gene:ENSMODG00000006548 transcript:ENSMODT00000008289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLEECGEDAALEPCRTPQASVTFKDVAVDFTWEEWRLLDPPQKELFWEVMLENYRNLV
CLGLADSNKDVRISELESGEPHWIPTGALFIFFLSGWESRPQNKESAPKMSISVKVLSQE
KFLEDDLRICKMAKAWECDGRLKKKQNIEGKPSRGIKIIQAEPPSEAGVSEHGKYLQTSS
PEPGLFPQQGTSVVMQGQKGDNQRGRSTMYLNQGQRDQIHSRKKRRKVNKCQKVLGHDLG
SIKRRGILSEEEVHERENSFPRINECGPHQTTDRGKKCNELTKWRKTGHAEHYCHHQSRE
RRYNCSECGKAFQEKGHLKAHYRIHTGEKPFKCSECGKAFQKKGNLKAHYRIHTGEKPFK
CSECGKAFLQKGDLKKHYRIHTGEKPCKCSECGKAFLQKGDLKKHYRIHTGEKPFKCSEC
GKAFPQKGDLKKHYRIHTGEKPVKCSECGKAFLHKGALKRHYRIHIGEKPFKCSECGRAF
QQRWHLKIHYRIHTGEKPFKCSECGKAFSRAGTLKGHQSTHTGEKPFNCSECGKTFQRNS
YLLSHQRRIHGGIHLHECDVCGKAFYGKHELTIHSRIHTGEKPYECSECGKAFSNKSCLT
HHSRIHAGE
Download sequence
Identical sequences H9H674
ENSMODP00000008125 ENSMODP00000008125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]