SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008150 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008150
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 252-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 463-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 24-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-22
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008150   Gene: ENSMODG00000022725   Transcript: ENSMODT00000008315
Sequence length 527
Comment pep:novel chromosome:BROADO5:Un:47428604:47440878:-1 gene:ENSMODG00000022725 transcript:ENSMODT00000008315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHKMPLSVFHWNLNDWSSVLALIPFKGSITFKDVAVNFTQEEWCLLDHSQKELYLEVVL
ENMQNLFSVGLPVSMEHFISCFQQGKAPWLLEQKGPRSSCPALLSSEAKTNFEVKEMSTK
LSLFVKGSGPKRCMTEDFHDFILKEICGSIIINNPKNDSDFDETAKKFSQYSVLNQYMKL
TSGNDCCQDSKNRKSFPEEVQLIQPHGNLPEIPMYQGNLGGMAFGRNLDLIRHPKSKPVE
MVSVSDKGGRPFSQNSELAAHQRIHTREKLYECKQCGKAFTQRVHLVTHQRIHTGEKPYE
CKYCGKAFTQRGHLAIHQRIHTGEKPYECKHCGKAFTERRNLAAHQRIHTGEKPYECKQC
GKAFTERGSLAKHQRIHTGEKPYECKQCGKAFIRRDYLAAHQTVHTGEKPFECKQCGKAF
TLKVSLAKHQGIHTGEKPYECKQCGKAFTERGNLATHQRIHTGEKPYECKQCGKAFIGRG
HLVTHQRIHTGEKPYECKQCGKAFTQRGSLAAHQRIHTGREPYECKY
Download sequence
Identical sequences H9H675
ENSMODP00000008150 ENSMODP00000008150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]