SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008161 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008161
Domain Number 1 Region: 42-105
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 472-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 273-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-19
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 7 Region: 203-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000175
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008161   Gene: ENSMODG00000006579   Transcript: ENSMODT00000008326
Sequence length 530
Comment pep:novel chromosome:BROADO5:3:447882952:447902104:-1 gene:ENSMODG00000006579 transcript:ENSMODT00000008326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLALAFLLEERALLSEEAALSQERSLEEENQKDTVGFLTARMQESVTFKDVAVDFTQE
EWKQLDPAQRDLYRDVMLENYRNLVSLAGLPVFKPDVISQLERGEAPWIPEVPRSICQGE
ETKWENKDSVPKPRFCVGEPSKELQLTQDGYWDFQLGSSWEYDVRLEEDSDNQERQSRQV
IFIPRKAASKVNVNEGNTYGAGFSLGSILDPQQLFPSGKSLHQCDMLEKSFKQFSELIKW
NRISLGKKLFKYNKCRKPTSYHLDLVQYDGLYIGEKLYECNECGKAFNWITHLTDHQRIH
TVEKPYKCNECGKAFSKHSYLNQHQNVHTGKKPHKCNECGKNFSQRGHLTEHQRIHSGEK
PYKCNECGKAFGQKAHLTEHLRIHTGEKPYQCSQCRKAFSQNSSLILHRRIHTGERPFEC
NECGKAFSQKGHLTQHRRIHTGEKLFECGECGKSFSHGSSYTYHQRIHTGEKPYECNECG
KAFSQNSSLTLHYRIHTGEKPFECNECGKAFRQRGNLTEHMRTHMGGKSF
Download sequence
Identical sequences F7B7L9
ENSMODP00000008161 ENSMODP00000008161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]