SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008165 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008165
Domain Number 1 Region: 360-485
Classification Level Classification E-value
Superfamily POZ domain 5.1e-28
Family BTB/POZ domain 0.00036
Further Details:      
 
Domain Number 2 Region: 756-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000541
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008165   Gene: ENSMODG00000006584   Transcript: ENSMODT00000008330
Sequence length 894
Comment pep:known_by_projection chromosome:BROADO5:3:153435570:153495510:-1 gene:ENSMODG00000006584 transcript:ENSMODT00000008330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAEMNRRTLAFRGGGLVTASSGGGGGSSSTNNNGGGGEAAAWPPQQQPRQQQQLNGRGA
DEEVELEGLEPEDLEAAAAAAAAGPVAAPAPAAAAAAAVAEEGKDLLLAADGGGPASLGG
GGGAGGPMFAERNRRTLAFRGGGGGGLSNNGSGGSAEASTWPPRHFNGRGTADEDLELDV
LEGKELVQDGASLSDSSEDEEEGASLGDGSGAEGGSCSSSRRSGGDGGDEAEGSSVGAGE
GESVQHFPLARPKSLLQKLHCSFQTSWLKEFSWLQYCQDTGLMSCSWCQKTPEDGGSGDL
PLVGHDELSRGTRNYKRALLLRHHLSAEHRLHESNTQESEGVPSESTNEEGYCDYNSRPN
ENSYCYQLLQELNNQRKKGILCDVDIVVSGRVFRAHKNILVAGSRYFKTLYCFTNKENLP
NKENHNQTTVTHLDVAAVQGFSVILDFLYSGSLSLNSQNAIEVMSVASYLQMTEVVQTCR
NFIKDALNISIKSEAPESVVVDYNRRSISRDGLPSSRDQKVARFWATRNLTNLASSIKSE
NDGCSIDEGQIENYQMNDCSWVQDSSPETAESESQGHSKVFVWNDMGSQGMQETGKARRK
NQTTKRFIYNIPPNNEENLEDCSVMQTSASYQEEDLQFIKEEPDLDGALLSGPDCDRNMN
SGLLAEANSSQDGGDAGPSNDFKYGLLPGTSNDFKYGLLPGTSNDFKYGLLPGTSNDFKY
GLLPESWPKQETWENGESSIIMNKLKCPHCNYVAKYRRTLKRHLLIHTGVRSFSCDICGK
LFTRREHVKRHSLVHKKDKKYKCMVCKKIFMLAASVGIRHGSRRYGVCVECTDKSQPGGQ
EGVDQVQDTDFTRDEEYEENEAGEADEELVDDGEEPTDPSRWDESGDVCMSLDD
Download sequence
Identical sequences F7B7I3
ENSMODP00000008165 ENSMODP00000008165 XP_003340650.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]