SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008213 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008213
Domain Number 1 Region: 501-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000047
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 53-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000129
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 276-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000131
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008213
Domain Number - Region: 168-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000381
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008213   Gene: ENSMODG00000006620   Transcript: ENSMODT00000008378
Sequence length 726
Comment pep:known_by_projection chromosome:BROADO5:1:169719247:169726755:-1 gene:ENSMODG00000006620 transcript:ENSMODT00000008378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSRPRSPGGPLALPAFDGELDLQRYSNGPGVSGGPAGMGAAGWPESRGSGRRFPCPVC
GKRFRFNSILALHLRAHPGAQPFQCPHCGHRTAQRALLRLHLRTHQPERPRSPAARLLLE
LEERALLREARLGSAPGVPLQPTPSAELPAPAPVPAPAPAPAPTLPAFRCPFCKGKFRTA
AERERHLHILHRPWKCNLCSFGSSQEEELLRHSLTAHGNPERSLAAASAAPQPMPLPLPP
PQPESESAPELEPAPEPEPAPAPATAPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKA
SFDHACPVCGRCFKEPWFLKNHMKVHASKLGALRAPGPGSAPPRAPPPADLGLLAYEPLG
PALLLAPAPPQGDRAEPPGLLGYLSLRAGKARPNGEGTETGGAGRGFGGFRPLPARERRP
RLEEPDEEEEDVVVEAEEDSWTRSRALGTLASLHRRPGEGPGHTAPAAGGQPRPAASQEE
NGLLVGGTRPEGGRGASGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSG
SLKYHLQRHHREQRSGAGPGPPPEPPPPPQRGSAPSQGAKPNPAPPTWAEGAMGSRLPSS
ATAPSRRKPVSPGRTLRNGRGGEAEPLDLSLRAGTGGEAGAGGSLHRCLFCPFATGAPEL
MALHLQVHHSRRARGRRPPQSAPSPPSSACVLSGELTPSPPQDGDGSPGLSRSGEAAGAG
VGGQER
Download sequence
Identical sequences F7GEQ7
ENSMODP00000008213 ENSMODP00000008213 XP_003340068.2.35504 XP_016283106.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]