SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008215 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008215
Domain Number 1 Region: 291-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 230-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008215   Gene: ENSMODG00000006622   Transcript: ENSMODT00000008380
Sequence length 466
Comment pep:known_by_projection chromosome:BROADO5:1:249999908:250023165:-1 gene:ENSMODG00000006622 transcript:ENSMODT00000008380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDELESKPELLVQFVQNTSIPLGQGLVESEPKDITCLSLLPVTETSECSRLVLPDDTP
SPTCKEVPSSAVLRSLQVNLGPDGEETRSHTVQKSPELLSTPESPSLLQDLQPSDNTSFI
LLNLTRAGLGSSAEHLVFVQDEAEDSGNDFLSSDSADSSMPWFIRVQELAHDSLIAATRA
QLAKSAKASSNGENVHLGSGEGQPKDSGSLPHLPQEEKRLQCTVEGCDRTFVWPAHFKYH
LKTHRNDRSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFVCPELGCGKQFTTAGNLKNH
LRIHTGEKPFLCEAEGCGRSFAEYSSLRKHLLVHSGMKPHQCQVCGKTFSQSGSRNVHVR
KHHSRMGATGNREREQTAEPLMGSSLLEETSVHSKSLVSLNSQPSLGVESLHLPDTNTIL
GVEEEVLAEGASRSLSSAPEVVLPQSHHLVPMSTGRQSYEVSALLQ
Download sequence
Identical sequences F7GEQ3
ENSMODP00000008215 ENSMODP00000008215 XP_001375517.2.35504 XP_016282564.1.35504 XP_016282566.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]