SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008310 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008310
Domain Number 1 Region: 207-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 38-97
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 180-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000378
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 253-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000275
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 337-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000204
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008310   Gene: ENSMODG00000006703   Transcript: ENSMODT00000008476
Sequence length 368
Comment pep:novel chromosome:BROADO5:4:342287999:342289102:1 gene:ENSMODG00000006703 transcript:ENSMODT00000008476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSWLPLPPLHYRFRDIALPEVSKIEEKEGGTSGGLAARFQESLTFKDVAVEFTWEEWRHL
DPAQRALHRNVMLENYENLVSIGIPVSKLDLFFLLKREDVQNEEGEAGTGTCIGIPVSKL
DLLFLLKREDVQNEEGEAGTGACIEGKIRLEMKEMTAELSLSGEETQKQRCIGDGACDST
WRENLDVHQRIHTGEKPFKCNQCGKAFTQKAGLIIHQRIHTGEKPFKCNQCGKAFTQKAG
LIIHQRIHTGEKPYECNQCGKTFAKRAHLTVHQRIHIGEKPFECNQCGKAFRLKYSFNLH
QRIHNGEAPFECHQCGKAFTQKSHFTAHQRIHTGGKPFECNLCGKAFTQKCGLTVHQRIH
TGEKSYDC
Download sequence
Identical sequences F7DGZ4
13616.ENSMODP00000008310 ENSMODP00000008310 ENSMODP00000008310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]