SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008323 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008323
Domain Number 1 Region: 220-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000222
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 253-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000125
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008323   Gene: ENSMODG00000006714   Transcript: ENSMODT00000008489
Sequence length 289
Comment pep:known_by_projection chromosome:BROADO5:8:233724149:233735033:-1 gene:ENSMODG00000006714 transcript:ENSMODT00000008489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYEGKTKTKTKIGIFQELQIVHDTGYFSALPSLEEYWQQTCLELERYLQSEPCCVSASDI
KFESQEDLWTKIILAREKKEESELKISSSPKEDSPISQSFSQSLETNSLNSDVSSESSDS
TEELSPTTKFTSDPISEVLANSGNLSSSVTSTPPSSPELGREPSSQLWNCMPGELHSPGK
IRTGTVGKTGEKVSGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSW
EGCEWRFARSDELTRHFRKHTGAKPFKCTHCDRCFSRSDHLALHMKRHL
Download sequence
Identical sequences F7DGJ3
ENSMODP00000008323 ENSMODP00000008323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]