SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008393 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008393
Domain Number 1 Region: 2180-2244
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-19
Family Homeodomain 0.0045
Further Details:      
 
Domain Number 2 Region: 2543-2613
Classification Level Classification E-value
Superfamily Homeodomain-like 1.24e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 3 Region: 2867-2937
Classification Level Classification E-value
Superfamily Homeodomain-like 4.11e-18
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 4 Region: 2085-2154
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-16
Family Homeodomain 0.011
Further Details:      
 
Domain Number 5 Region: 2954-2998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000681
Family HkH motif-containing C2H2 finger 0.0004
Further Details:      
 
Domain Number 6 Region: 1493-1567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000248
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 1351-1398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000867
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number 8 Region: 687-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000425
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 739-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000369
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 1904-1926,2262-2287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000523
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008393
Domain Number - Region: 2444-2466,2621-2646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00021
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 3389-3436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000975
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 1012-1057
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00213
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 901-946
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00886
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 1171-1196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0174
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 613-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0232
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008393   Gene: ENSMODG00000006777   Transcript: ENSMODT00000008561
Sequence length 3575
Comment pep:known_by_projection chromosome:BROADO5:3:158717783:158921010:-1 gene:ENSMODG00000006777 transcript:ENSMODT00000008561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METCDSPTISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLRTDERKSEI
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENLTGEIVYQPDGSAYIIEDSKESGQNAQTAANSKLFSTAMFLDSLTSAGEKNDQS
ASAPMSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKRDKDY
LTSDGSAKNSCVSKDVPNNVDLSKFDGCVSDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNEEEQKLLSNKYVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSLQAGFAFLKGSASTASSAEQPLGITQMPKAEVNLGGLSSLVVNTPI
TSVSLSHSSSESNKLSESKDQENNCERPKETNILHPNGEFPIKSEPTEAVDEEDEDNYSN
ELDDDEVLGELTDSIGSKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTDKKKQTA
ALRHSGSATNNYSIGGKDFADASANKDSTPVLHPNETARGDEDSSATPHQHSFTPSTPGT
PGPGDGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLEA
HMKEKHPEPGGSCVYCKTGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSD
KHLNNVQNLQNGNGEPVFGHTAPAPNTSLSGCGTPSPSKPKQKPTWRCEVCDYETNVARN
LRIHMTSEKHMHNMMLLQQNMKQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMKLENPAD
PQMMINPFQLDPATAAALAPGLGELSPYISDPALKLFQCAVCNKFTSDSLEALSVHVSSE
RSLPEEEWRAVIGDIYQCKLCNYNTQLKANFQLHCKTDKHMQKYQLVAHIKEGGKTNEWR
LKCIAIGNPVHLKCNACDYYTNSVDKLRLHTTNHRHEAALKLYKHLQKHESAVNPESCYY
YCAVCDYSTKVKLNLVQHVRSVKHQQTEGLRKLQLHQQGLSPEEDNLSEIFFVKDSPPNE
LETASLGARVCEDDLTEQHEEPEAAIKSTSVLADDDKDTSEKDSSEGKKASHDPANVAIG
TQQLLQAKEDDGAAKRSKSAEDNKFCHEQFYQCPYCNYNSRDPNRIQMHVLSQHSMQPVI
CCPLCQDVLSNKMHLQLHLTHLHSVSPDCVEKLLMTVPVPDVMMPNSMLLPTATTEKSER
DTPATIITEGSGKYSGESPLDDKNIPGLEESKTGMEIKVEEQKPPKESTDMLEWNKNGSK
DVKVTDSLQDQLNEQQKRQQLSVSDRHVYKYRCNHCSLAFKTMQKLQIHSQYHAIRAATM
CSLCQRSFRTFQALKKHLEAGHPELNEGELQQLYASLPVNGELWAENENMAQDDHALEQE
IEREYEMDQEGKASPVGSDSSSIPDDMGSEPKRTLPFRKGPNFTMEKFLDPSRPYKCTVC
KESFTQKNILLVHYNSVSHLHKLKKVLQEASSPVPQETNSSTDNKPYKCSICNVAYSQSS
TLEIHMRSVLHQTKARAAKLEPSGTISGGNSITTNVNSPGQGMLESMSLPAVNSKDTHLD
AKELNKKQASELISVQPPHHPPQSPAQLQMQLQHELQQQAAFFQPQFLNPAFLPHFPMTP
EALLQFQQPQFLFPFYIPGTEFSLSPDLGLPGSATFGMPGMAGMAGSLLEDLKQQIQTQH
HVGQTQLQILQQQAQQYQATQPQIQSQKQQQQQQQQQQQQQQQQQQATKLLKQEQNSLGN
VDCPLMKDLPSYKDTEEICEKPEKPKQEFTNENEGLKENKDMKKQKPIEPTIPPPRIASG
ARGNAAKALLENFGFELVIQYNENRQKVQKKNKAGEGENTDKLECGTCGKLFSNVLILKS
HQEHVHGQFFPYGALEKFARQYREAYDKLYPISPPSPETPPPPPPPPPLPPTPSQSSSVG
SGKIQSTPPTPLQAPPPTPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLFPPIMMQP
VQHPALPPQLALQLPQMDTLSADLTQLCQQQLGLDPNFLRHSQFKRPRTRITDDQLKILR
AYFDINNSPSEEQIQEMAEKSGLSQKVIKHWFRNTLFKERQRNKDSPYNFSNPPITVLED
IRIDPQPTTLEHYKSDASFSKRSSRTRFTDYQLRVLQDFFDTNAYPKDDEIEQLSTVLNL
PTRVIVVWFQNARQKARKSYENQAETKDNEKRELTNERYIRTSNMQYQCKKCSVVFPRIF
DLITHQKKQCYKDEDDDAQDESQTEDSMDATDQMVYKHCTVSGPIDTAKNSAVTAASSGS
GSSTPLIPSPKPDPEKTSPKPEFPQEKPKQSDASPPSQSTKPILPVATPSSDTQPSASQS
QPPKQSQLIGRPPSASQTTPVPSSPLPISMTSLQNSLPPQLLQYQCDQCTVAFPTLELWQ
EHQHMHFLAAQNQFLHSQFLERPMDMPYMIFDPNNPLMTGQLLTGPLAQMPPQTGSSHTT
APATVSGSLKRKMDDKEDNNCSEKEGGNSGEDQHRDKRLRTTITPEQLEILYEKYLLDSN
PTRKMLDHIAREVGLKKRVVQVWFQNTRARERKGQFRAVGPAQSHKRCPFCRALFKAKSA
LESHIRSRHWNEGKQAGYSLPPSPLIATEDGGESPQKYIFFDYPSLSLTKIDLSSENELA
STVSTPVSKTAELSPKNLLSPSSFKAECTEDIENLNAPPAEAGYDQNKTDFDETSSINTA
ISDATTGDEGNNEMESTTGSTGDIKPVLSPKEPKTLETLPKTATTPTTEGCDDKFLFSLT
SPSIHFSDKDGDHDQSFYITDDPDDNADRSETSSIADPSSPNPFGSSNPFKSKSSDRPGH
KRFRTQMSNLQLKVLKACFSDYRTPTMQECEMLGNEIGLPKRVVQVWFQNARAKEKKFKI
NIGKPFMINQSGTDGTKPECSLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKDY
LAPTTVRQLMAQQELDRIKKATDVLGLSVQQPGMMDSSPLHGISLPAAYPGLPGLPPVLL
PGMNGPSSLPGFPQNSNCNAGMLGFPTSAPPSPALSLSSAPTKPLLQTPPPPPPPPPPPP
PPPPPSSLSGQQTEQQSKESEKKQTKPNKVKKIKEEELETTKPEKHLKKEEKISSALSVL
GKVVGETHVDPTQLQALQNAIAGDPASFIGGQFLPYFIPGFASYFTPQLPGAVQGGYLPP
VCGMESLFPYGPAVPQTLASLSPGALLQQYQQYQQNLQDSLQKQQKQQQQQQQQQQQEQQ
QKLVQAKSSKVESEQQQQQQEAAETKEDKSSAPESTKEEPQLDSKSADFSDTYIVPFVKY
EFICRKCQMMFTDEDAAVNHQKSFCYFGQPLIDPQETVLRVPVSKYQCLACDVAISGNEA
LSQHLQSSLHKEKTIKQAMRNAKEHVRLLPHSVCSPNPNTTSTSQSAASSNNTYPHLSCF
SMKSWPNILFQASARRAASSPSSPPSLSLPSTVTSSLCSTSGVQTSLPTESCSDESDSEL
SQKLEDLDNALEVKAKPASGLDGNFNSIRMDMFSV
Download sequence
Identical sequences F7BTH3
ENSMODP00000008393 ENSMODP00000008393 13616.ENSMODP00000008393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]