SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008631 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008631
Domain Number 1 Region: 8-60,123-182
Classification Level Classification E-value
Superfamily POZ domain 3.65e-21
Family BTB/POZ domain 0.0049
Further Details:      
 
Domain Number 2 Region: 333-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000732
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 235-257,306-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000605
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008631   Gene: ENSMODG00000006962   Transcript: ENSMODT00000008801
Sequence length 568
Comment pep:known_by_projection chromosome:BROADO5:2:255169821:255189507:1 gene:ENSMODG00000006962 transcript:ENSMODT00000008801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPAEVTDPSHAPAVLHQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREALL
AQAPSPLPPVTRDPAPNPSTSSASSSSSSSSSSSSSSSFSSSSSSSFSSSSSSSSSPPPL
SSSPTVSHPPRVLELPGVPAAAFSDVLNFIYSARLALPGGGGDGAAMAEIGALGRRLGIS
RLQGLSESGDAWVPPAPAPPAPVEIDSFTTGPSKEWQGSGNEVSTVQTSLPRRSLPCPRC
GKSFIHAKRLQTHEAQCRRGTGTRGTVSGQGNGGSQEENPEGIRNSSASPSTSFRGGPEH
VVKVVGGHVLYVCGACERSYVTLSSLKRHSNVHSWRRKYPCRYCEKVFALAEYRTKHEVW
HTGERRYQCIFCWETFVTYYNLKTHQRAFHGISPGLLASEKTPNGGYKPKLNTLKLYRLL
PMRSAKRPYKTYSQGAPPAPVSAPLSPEPTPSASTIPPLLPTTPPPPPVPPPPPTPAPPP
SVIAFAHPAPSVIVHGGSSTGSGMTGTTGAQAASVIAYTAPPRPPKKREYPPPPPQPAVA
VVTATPSTPATTTTGATAEETKDHSSNR
Download sequence
Identical sequences F6QVE7
ENSMODP00000008631 ENSMODP00000008631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]