SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008746 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008746
Domain Number 1 Region: 70-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 14-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.04e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 133-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008746   Gene: ENSMODG00000007052   Transcript: ENSMODT00000008919
Sequence length 510
Comment pep:novel chromosome:BROADO5:4:413765974:413767575:1 gene:ENSMODG00000007052 transcript:ENSMODT00000008919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGEKPFQCHDCGKAFNQNSNLHQHQRIHTGEKPFKCNDCEKAFNRSSTLLKHQRIHTGEK
PFQCHDCGKAFNQNSHLLQHQRIHTGEKPFQCHDCGKAFNQNSHLLQHQRIHTGEKPFQC
HDCGKAFNQSHLNSFHLLQHQRIHTAEKSFQCHDCGKVFSHRSKFIIHQRIHTGEKPFKC
HDCGKAFNQNSNLHQHQRIYTGEKPFKCDDCGKAFNQISHLLQHQRIHTGEKPFQCHDCG
KAFNQNSNLHQHQRIHTGEKPLKCNDCEKAFNRSSTLLKHQRIHTGEKPFQCHDCAKAFN
QNSHLLQHQRIHTGEKPFQCHDCGKAFNQNSHLLQHQRIHTGEKPFQCHDCGKAFNQNSH
LLQHQRIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTNERPFKCNDCGKAFNQSFHLLQH
QRIHTAEKPFQCHDCGKVFSHRSKLIIHQRIHTGEKPFKCHDCGKAFNRISNLLKHQRIH
TSEKPFKCNDFGKAFNQSSNLIVHQRIHNG
Download sequence
Identical sequences F6UFA0
ENSMODP00000008746 13616.ENSMODP00000008746 ENSMODP00000008746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]