SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008794 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008794
Domain Number 1 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.6e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 569-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 47-106
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 266-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000522
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 169-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008794   Gene: ENSMODG00000023473   Transcript: ENSMODT00000008967
Sequence length 630
Comment pep:novel chromosome:BROADO5:3:521494848:521645184:1 gene:ENSMODG00000023473 transcript:ENSMODT00000008967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVELLCCFYREPGASGMAFERDRLPAQPKSAGVEEDPGLCLLLLSTKVVTFKDVAVEF
TREEWHLLSPPQKELYKEVMLENAWNLLSMGLPAPSEDILSYLEQREALWMLEQEGLTSC
CPGEIIPELKANPTEMSPPVEEMDLQRFMSVGPKNFTSREFCVASRNLSPIEHQRMHTEK
QSRESNQCGKNFIHRASLAQNQRLYTSEQAYECKQYRNTFSQSSSLAQHQRRHTGEKSFE
CKQCGKTFSQSSNLAQHQRIHTGEKPYKCKQCGKTFSRSSYLVKHHRRHTGEKPYECKQC
GKTFSQNSRLVQHQRVHTGEQPYECKQCGKTFSMSSSLARHQRIHTGEKPYECKQCGKKF
SENSNLTVHQRRHTGEKPYKCKQCGKTFSHSSDLARHQRRHTGEKPYKCKHCGKTFSLSS
ELAVHQRRHTGEKPYECKQCGKTFSLSSDLAVHQRRHTGEKPYECKQCGKTFSQSSNLAR
HQRSHTGEKPYECKQCGKTFSQSSNLAIHQRRHAGEKPYNCKQCGKTFSLSSDLAIHQRS
HTGEKPYECKQCGKTFSLSSNLARHQGIHTGEKPYKCKQCGKTFSQSSDLAVHQRRHTGE
KPYKCKQCGKTFSLNSNLTRHRSIHTGKKL
Download sequence
Identical sequences F6UEI4
ENSMODP00000008794 ENSMODP00000008794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]