SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008796 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008796
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.04e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 27-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.02e-17
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 199-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008796
Domain Number - Region: 278-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000122
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008796   Gene: ENSMODG00000023421   Transcript: ENSMODT00000008969
Sequence length 586
Comment pep:novel chromosome:BROADO5:3:524251367:524263257:-1 gene:ENSMODG00000023421 transcript:ENSMODT00000008969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLGLLYCFYRELGVPGMAFERDRLLAQEVVTFKDVAVEFTREEWHLLSSPQKELFKEV
MLENAWNLLFVGLPPKDLVSSLEQKEALWMLEQEGLRSCCPHEGGQKTWNFFFKVLGNGN
AFNSTGKSGTRGVKRMIIRPEMKVNPTEVSFSLEEMNLQCFMSDCPNFAFREFCVAPQNL
SHIEHQRMNTEEKSTESYRCRKTFLQRASLARHQRIHTGKKSYECNQFGRTFSYTSRLAV
HEKVHSGEKPYECKQCGETFSRSSCLAVHQRMHTGEKPYECNQREKTFSQCSGLAAHQRI
QNVQKPHECKQCGKTFSQRSGLAIHRRIHTGEKPYECHQCGKSFTGYSSLVRHQRIHTGE
KPYECKQCGETFTQNSHLAVHQRIHTGEKPYECKQCGKTFSQNSHLARHQRMHTGEKPYK
CNQCGKTFSNSSGLTVHQRIHTGQKPYECNQCGKTFSHYSGLALHQRIHTGEKPYECKQC
GKTFSQSSHLARHQRMHTGEKPYKCNQCGKTFSNSSGLTVHQRIHTGQKPYECNQCGKTF
SHYSGLALHQRIHTGEKPYECNQCGKTFRQSSNLAVHQRMHSGEKP
Download sequence
Identical sequences F6UEH5
ENSMODP00000008796 ENSMODP00000008796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]