SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008810 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008810
Domain Number 1 Region: 1379-1726
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.44e-80
Family Formin homology 2 domain (FH2 domain) 0.0000381
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008810
Domain Number - Region: 666-736
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0127
Family DEP domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008810   Gene: ENSMODG00000007102   Transcript: ENSMODT00000008983
Sequence length 1746
Comment pep:known_by_projection chromosome:BROADO5:2:148088638:148573010:-1 gene:ENSMODG00000007102 transcript:ENSMODT00000008983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQIHKLEVKIPVIQTTFLELPFLAGQKRGRGGGGDPPRAQQQLRQEQPLEGAVCGGECC
TEHVRAHQSPSCSSSSSSRSRLALCKAEAPADGRGAKQERVSFPAGQFAHWPGFPSSLPQ
TKPGNETLWDGLTADWAALQRDCNMGNQDGKLKRSAGDISHEGGGGGGCVGEDAVGPRDA
EGTKKGSGGKKALGKHGKGGGGSSTGESGKKKSKSDSRASVFYNLRIRKNLSKGKGGAGS
REDVLDSQAIQTGELDSAHSLVTKTPDLSLSADEVGLSDTEGTDPFEVSRPNVVGPAGLG
VQSTVEGDLEAVPGAQDGQRTSSGSDTDIYSFHSATEQEDLLSDIQQAIRLQQQQQQQQQ
HQGGAVSSGDPSASLGSAPLQPGAFLGLDHFLLGPVSRVGEAPGSPDTEQALSALSDLPD
SLPPEPLAQEKTPPPSGVDWEVTAPVATLPVATDSPSSTAFPFPEPGLGETATVASSVGG
AGDTDDDDEDAFEDAPRGSPGEEWDKGTQQTPSEVEEEGDILRAYPTPPQMDSPAPSPRC
FKPYPLINPCYIKTTTRQLSSPNHSPSQSPSQSPRIKRRLEPSLSRGQRATLVSTAAQVK
KHKTSGSSLVGGLSRSADWTEEVEQREPRVGGSADLLQYGTAQEGTDGTPPTLSRKSSGV
PAANDVFQNVFTGRTLLEKLFSQQENAPPEEAEKFCSRIIAMGLLLPFSDCFREQCNQSV
QQSSAPFDQDQLYTWAAVSQPTHSLDYTEEQFPRRIPPVWPPAKASDEEHGPKDTETEDT
EEFQATISETPKQCADAVQQETFDMKSEEHANVIQQLEQTIENLRTKIAELEKQYPATEV
EVDKGKQVAERGVAEGVCHEDIHLNEEEIRHQRMLHVKSVQTSPTEEGSASVMPFANTLP
QHPPFTQEGINGQPNVPLSPSGPQTKFCSEISLIVSPRLISVQLDANQSIQCVSQPPPPP
PLPGSDNQENILTQTSPMPFITESVTNHEHLLPTSFESSHGILPSPHLTGTELNPPLPGA
GIPPPPPLPGVDIPSPPPLPPWPDTGPSIFMPGSGMIPPPPPLPGMTVLPPPPPLPGTGV
PPPPPLPGAGVPPPPPPLPGAGVPPPPPLPGTGVPPPPPLPGAGVPPPPPLPGAGVPPPP
PLPGAGVPPPPPLPGAGVPPPPPLPGVGVPPPTPPLPGVGIPPPPPLPGTGVPPPPPLPG
VGIPPPPPPLPGMAVPPPPPPLPGMGVPLPPPLPGMGVPPPPPPLPGVGVPPISAPPLPP
GSGPPPLPQDGGSTLPNMMLPQVCGFLPPPLPAGLFGIGLHQDKVSRKQAIEPCRPMKPL
YWTRIQLHNRRDSSTSLIWEKIEEPSIDCHEFEELFSKTAVKERKKPISDTITKTKTKQV
VKLLSNKRSQAVGILMSSLHLDMKDIQHAVVNLDNSVVDLETLQALYENRAQSDELEKIE
KHGRSCKEKENAKSLDKPEQFLYELSLIPNFSERVFCILFQSTFSESICSIRRKLELLQK
LCETLKNGSGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLS
YIVSYYLRNFDEDAGKEQCVFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLRACETEAGK
VYQMSLEEHIQPFKESMEQFICQAKIDQEAEEHSLTAAHKCFLETTAYFFMKPKMGEKEV
SPPVFFSLWHEFSSDFKDFWKKENKLILQERVKEAEEVCRQKKEKSLYKIKPKHDSGIKA
KISMKI
Download sequence
Identical sequences F6Q8N7
ENSMODP00000008810 ENSMODP00000008810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]