SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008948 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008948
Domain Number 1 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 642-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 12-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-17
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 10 Region: 217-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000133
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008948   Gene: ENSMODG00000007220   Transcript: ENSMODT00000009125
Sequence length 693
Comment pep:novel chromosome:BROADO5:3:523886211:523894322:-1 gene:ENSMODG00000007220 transcript:ENSMODT00000009125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGPPGAGARQGTLTFQDVAVIFSPGEWRLLGRAQRELYREVMLENYWTLAWLAGFVGA
QPEVISHLEQADMPWVPEDSFPSSNHTDLDTKLQIKTSTPQHGLTVEEFSEKRPLSDVPW
ILTVGGDWECNLKLKEEWSKEDQHLRRVTITKRKSPKEMSVHEYKNDRSSNLEPRKQFFV
GKNLLHKYDRQRKSFRKYSAIKQSNRTCLKKILSHDNKCQKSFSYNFDCTEKRRVHARKK
LYDCNECGKTFLQNTELALHQRIHRGEKLYQCSECGKVFQQNSYLRKHQKIHSAEKPYEC
GECGKAFHWRSQLTEHQRIHTGEKPYVCNKCGKAFLRGYEIIRHQRVHIGEKTYECHECG
KVFRRTSCFQKHQRRHTEEKVYKCNECGKTFHCNSYLNEHKRIHSREKPYVCNDCGKAFL
RATELMRHQRRHARGKHYECNDCGKVFQQNSYLRRHQRIHTGEKPYECTECGKAFLRATG
LTRHQRTHTRGKPYECNECGKTFQQNSYLIVHQRIHTGEKPYECTECGKTFVRSTNLSQH
QRTHTGEKPYECNECGKAFRCKSHLIDHQRIHTREKPYVCNECGRAFVCSSNLGHHQRIH
TGEKPYECNECKKAFCKRADLTQHQRRHTGEKPYECNECGKTFSQNSYLRRHQRIHTGEK
FYACNECGKTFLQSSELTQHQRIHSEEKLYECN
Download sequence
Identical sequences F6WSH2
ENSMODP00000008948 XP_016288508.1.35504 XP_016288509.1.35504 XP_016288510.1.35504 ENSMODP00000008948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]