SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008996 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008996
Domain Number 1 Region: 158-290
Classification Level Classification E-value
Superfamily Acid proteases 4.22e-41
Family Retroviral protease (retropepsin) 0.0000718
Further Details:      
 
Domain Number 2 Region: 36-167
Classification Level Classification E-value
Superfamily dUTPase-like 7.33e-21
Family dUTPase-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008996   Gene: ENSMODG00000007260   Transcript: ENSMODT00000009173
Sequence length 302
Comment pep:novel chromosome:BROADO5:1:676512625:676513791:-1 gene:ENSMODG00000007260 transcript:ENSMODT00000009173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRRDGPPNHVGWANSSPGTGKRDAGLLQEPLSSSLTRATAGSTGLDLCASTTRILTPEEG
PIVLPTGKFGPPPPGMFFLVIGRVLTTLQGVVVHPTLVDNDYTGEIKIIIESPHGPVTIL
AGRRLAQALPLPMIGKFPEVAHTRGPFSPGSSHIYWVQQLTESRPTLQLKIEGKTFTGLL
DTGADSTVISQAHWPCSWPLQPSSTHLSGIGQVQDTLQSSKVLNWQDTEGNSGTSRPYVV
AGLPVNLWGRDILAQMRLLMVSPSDPVTTMMLKSGYLPGKGLGKREQRPHKDREGLGLQS
FS
Download sequence
Identical sequences F6VWE0
13616.ENSMODP00000008996 ENSMODP00000008996 ENSMODP00000008996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]