SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009170 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009170
Domain Number 1 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 559-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 11-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 8 Region: 602-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-18
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 236-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009170
Domain Number - Region: 217-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0132
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009170   Gene: ENSMODG00000007392   Transcript: ENSMODT00000009351
Sequence length 664
Comment pep:novel chromosome:BROADO5:3:523814716:523838043:1 gene:ENSMODG00000007392 transcript:ENSMODT00000009351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGPSEAGSPEGSVMFRDVAVLFSPDEWGRLGQGQRELYWEVMLENYQTLVWLGLAVTK
PDVISLLERGRTPWMPAPGGPRSSCPDWNTRNKSKESTPQPGISMVESSQKRLSGDSLWI
LKKGGASECYGRSKEEQSNENQYFRQLKIAKGKSSEVRGQQHTKWRSILVPVVFPQKRLF
VGKNIHKCDTQRKSIRMYSDTTQYNRNCLKKKFSNDDRCQKYFDYNFDHTEKHRLHTGKK
LYECNECEKSFLKNTELTLHQRIHRGEQLYECTECGKAFQQNSYLRKHQKIHTGKKPYEC
NECGKAFHWRTQLTEHKRIHTGEKPYVCNECGKSFLWSSNFTRHQRTHTGVKPYECSECG
KAFCQNSYLRKHQKIHTGEKPYECNECGKTFQCRTRLAKHQRIHTGEKPYVCTECGKAFL
WSTDLIRHQRTHTGEKSYECNECGKAFWDKTGLTQHHRIHVGEKLYKCNDCGKVFLQSTT
LIRHQKIHTGEKPYQCNECGKAFYQRAELIRHHKIHTGEKPYECFECGKAFYQRAALTQH
YKIHTGERPYKCNECGKGFHHNSHLIQHQKIHTGEKPYECYECGKAFAWSMALTQHQKIH
TGEKPYECNECRKTFCVRAELNQHYRVHSGEKPYKCNECGKAFSRNTTLIRHYSIHTEEK
LYSM
Download sequence
Identical sequences F6YZX4
ENSMODP00000009170 XP_016288512.1.35504 ENSMODP00000009170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]