SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009185 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009185
Domain Number 1 Region: 57-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 3-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009185   Gene: ENSMODG00000007401   Transcript: ENSMODT00000009366
Sequence length 126
Comment pep:novel chromosome:BROADO5:Un:15043299:15043767:-1 gene:ENSMODG00000007401 transcript:ENSMODT00000009366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KELLITHQRTHTEKKQCECNECGKAFTQRNHLICHQGIHTGEKPFQCKECGKIFRVKNLV
RHQMTHTGEKPFECNECGKAFNQKGHLTIHQSTHTGEKLFECNKYGKTFSVRQHLLKHQR
THTEEK
Download sequence
Identical sequences H9H697
ENSMODP00000009185 ENSMODP00000009185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]