SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009186 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009186
Domain Number 1 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.59e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 71-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 22-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000023
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009186   Gene: ENSMODG00000007402   Transcript: ENSMODT00000009367
Sequence length 282
Comment pep:novel chromosome:BROADO5:3:167275324:167276259:-1 gene:ENSMODG00000007402 transcript:ENSMODT00000009367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNECEKHFCSSRRPPTKQQRIHSAQKFYECHVCGRTFCQLAELTQHQAIHRGENPFECIE
CGKAFSQSSQLILIQHQRIHSEEKHFECNECGKAFCQRIQLTVHQRIHTGEKPYECKECR
KPSTEIQDLPNIKKLIQERTLMNAMTMERPAEKIHTREKLYECNECGKAFCHRSQLTQYQ
IIHTGEKLYECSKCGKVFHQTSQLIRHKVIHTGEKPFECDQCGKAFHRSTRLIQHQRIHM
GEKPYECKVCAKTFHMSSQLTQHMVIHTREKPYECNECGKAF
Download sequence
Identical sequences F6YZ00
13616.ENSMODP00000009186 ENSMODP00000009186 ENSMODP00000009186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]