SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009205 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009205
Domain Number 1 Region: 47-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-36
Family SCAN domain 0.00013
Further Details:      
 
Domain Number 2 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-27
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 161-220
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-25
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 4 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 392-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 362-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000567
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009205   Gene: ENSMODG00000007417   Transcript: ENSMODT00000009386
Sequence length 650
Comment pep:novel chromosome:BROADO5:1:669830682:669844579:-1 gene:ENSMODG00000007417 transcript:ENSMODT00000009386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EETLSLNEEMATSGSTQHPHLQEQDEVLRMSFSEENETHLKGNTFDAAISHRNFRHFQYS
EADGPQKTLHHLRELCHQWLRPDIHTKEQILEMLVLEQFWAILPGEIRTWVKSHHPKNGE
EVVNLIEDLTQMLKEEVLPSQDSGLPQEEERVVPEVMIVNSQKSTEFRDVAVDFTLEEWD
LLDSAQRDLYRDVMLENYRNLVSLGLSIPKPDVVTQLEQSQAPVMLEKEVSRCSSPDKKT
PSRITELIPKQDTTLKASAQEQLTRDGSSDCSLETPRKCEIRLEKQQDNQKKHCQQATVG
HKKTSKNISSHECKKSESLNGEQILSPKEKISAGKNLHKCDTHLRNFKQYSGPKLTKGNQ
VPTSGKKPCKVNECKKMFIPHSDLNEYDKRTSGELPYKCDKCGKVFHWKRHLVQHQKIHT
GIKTYECNECGKTFRHSSSLPAHLRIHTGEKPYKCSDCGKAFNYSSSFFEHIRIHTGTKP
YSCDICGKAFNHSSSLTEHERIHTGEKPYECNECGKSFSQMGHLTKHHRIHTGEKPYTCS
ECGKSFSWSADLTQHQRIHTGEKPYECNECGKTFRWNTYLTQHQRIHTGEKPYKCNECGK
SFRQKGHLTQHQRIHTGEKPYHCNECGKAFSVSSSLIKHQKIHTGKRFYK
Download sequence
Identical sequences F7EE73
ENSMODP00000009205 13616.ENSMODP00000009205 ENSMODP00000009205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]