SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009236 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009236
Domain Number 1 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000717
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 239-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000977
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 288-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000244
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 403-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000256
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000104
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009236
Domain Number - Region: 473-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00794
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009236   Gene: ENSMODG00000007443   Transcript: ENSMODT00000009417
Sequence length 878
Comment pep:novel chromosome:BROADO5:6:249613726:249650329:1 gene:ENSMODG00000007443 transcript:ENSMODT00000009417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIQGLLAAQTPRGNQHGGGSRGGAACPRVLPLLLLDEKPPPPQQPTSAASGPAVDAASS
PQPPLLAPEGGGGGGGDSFLVVFNVGRGAETEAGGTSGASPAPRAPVRPREQSPASAPCG
PPAPAAAFAGTITINNQNLIVRIENGFLTLAAPLAAEPSAAKAGPQPPGPPPPPGCGSGP
GGGGAGGSSTGVVLVYHCPEPECPQTFPKKHQLKLHLLSHSSTQGQRPFKCPLDGCGWSF
TTSYKLKRHLQSHDKLRPFSCPAGGCGKRFTTVYNLKAHMKGHEQENTFKCEVCAERFPT
HAKLAAHQRSHFEPERPYKCEFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCNKQY
DKACRLKIHLRSHTGERPFICDSDGCGWSFTSMSKLLRHKRKHEDDRRFTCPVEGCGKSF
TRAEHLKGHSVTHLGTKPFECPVEGCCARFSARSSLYIHSKKHLQDVDALRSRCPVSSCN
KLFTSKHSMKSHMAKQHNFSSDLLSQLEATSFLTPSSELTSPGQSDLSNIDLVSLFSNVS
SNNSAITTDMALVNSGILTIDVASVSSTLGGNLSVNNTNSLGQAMDPLILVASSDMPHSL
DSSLLLGTTATVLQQSTLNLDDVQTVNAEALGSLASLSVKNSSQDLHALTSSNNLTIEPA
TLTPSSSLTGSSVPSLLTPTKTERDLLPSSDIVGQQEGSKVVTQFVFSNPAAGYSAQKDM
DLSTVPASSFLESGGSARTDYRAIQLVKKKKEKGPGSSTGSSGSTQRKLKGGKVSPTNFS
TSPSSRLCGNIVVPNGGLTVRDPATGAQFVQIQLLQDDPPGDGDLPFQLSSQSSTPHSQL
TVDLPVHILQEPHTSTEDDAGSDNSQFTGSTINLQDLE
Download sequence
Identical sequences F7DW67
ENSMODP00000009236 ENSMODP00000009236 13616.ENSMODP00000009236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]