SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009239 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009239
Domain Number 1 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 245-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 206-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 487-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000788
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 403-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000472
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 175-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000647
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 140-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000105
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009239   Gene: ENSMODG00000023147   Transcript: ENSMODT00000009420
Sequence length 591
Comment pep:known_by_projection chromosome:BROADO5:1:591065787:591074126:1 gene:ENSMODG00000023147 transcript:ENSMODT00000009420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVAFKDVAVDFTQEEWGQLDPAQRDLYRDVMLENYGNLVSLGFPVSKPYVISQLEQGEE
PWVVEREVSRGICLDLEARAEIKETAKQDISKEESSQEVIIQRFTKDSLRNPQSGDTWQH
EVWLQGQQRSQETYLREMAINHKQSPIWEKDHGCNDLKKSFSLSSILVAQQKVPTGEKPY
KYDANGNNFRQNPLIIGHQKIDLRNKPCKCNECGKAFRYHSELTRHRRTHTGEKPYECNE
CGRGFSQSSSLTLHLRFHTGEKPHKCNECGKAFRHTSSLVKHQRSHTGEKPYECSECGKA
FSRSTHLTEHQRIHTGEKPYKCNECGKTFSRSTHLTEHQTIHTREKPYKCNECGQAFSHT
SSLVKHQRIHTGEKPYECNECGKAFSRRTHLTQHQTIHTGEKPYECNECGKAFSHILFLT
KHRKIHTEEKPYECDECGKAFSHTSSLIKHQRTHTGEKPYKCNECGKAFSHTSSLNKHQR
THTGEKPYECNECGKAFSQSSSLALHQSCHTGERPYSCSECGKAFSHTASLIKHQRTHTG
EKPYECNQCGKAFSQSSSLIKHQRTHTGEKPYGCNECGKAFSQSSSLFKHQ
Download sequence
Identical sequences F7DW41
13616.ENSMODP00000009239 ENSMODP00000009239 ENSMODP00000009239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]